HLA-DPB1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16874T
Artikelname: HLA-DPB1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16874T
Hersteller Artikelnummer: CNA16874T
Alternativnummer: MBL-CNA16874T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 40-100 of human HLA-DPB1 (NP_002112.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 3115
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRA
Target-Kategorie: HLA-DPB1
Application Verdünnung: WB: WB,1:500 - 1:2000