HOXD8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16877T
Artikelname: HOXD8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16877T
Hersteller Artikelnummer: CNA16877T
Alternativnummer: MBL-CNA16877T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human HOXD8 (NP_001186675.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 3234
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQELEEDRAEGLTN
Target-Kategorie: HOXD8
Application Verdünnung: WB: WB,1:500 - 1:2000