Myelin Protein Zero (MPZ) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1687S
Artikelname: Myelin Protein Zero (MPZ) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1687S
Hersteller Artikelnummer: CNA1687S
Alternativnummer: MBL-CNA1687S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-153 of human Myelin Protein Zero (MPZ) (P25189).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 4359
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTR
Target-Kategorie: MPZ
Application Verdünnung: WB: WB,1:500 - 1:1000