IGF1R Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16884T
Artikelname: IGF1R Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16884T
Hersteller Artikelnummer: CNA16884T
Alternativnummer: MBL-CNA16884T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 741-935 of human IGF1R (NP_000866.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 155kDa
NCBI: 3480
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIH
Target-Kategorie: IGF1R
Application Verdünnung: WB: WB,1:500 - 1:2000