Collagen I/COL1A1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16891P
Artikelname: Collagen I/COL1A1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16891P
Hersteller Artikelnummer: CNA16891P
Alternativnummer: MBL-CNA16891P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human Collagen I/COL1A1 (NP_000079.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 139kDa
NCBI: 1277
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: GEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSF
Target-Kategorie: COL1A1
Application Verdünnung: WB: WB,1:1000 - 1:5000|IHC-P,1:2000 - 1:10000|IF/ICC,1:50 - 1:200