LAMP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16894S1
Artikelname: LAMP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16894S1
Hersteller Artikelnummer: CNA16894S1
Alternativnummer: MBL-CNA16894S1
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human LAMP1 (NP_005552.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 3916
Puffer: PBS with 0.09% Sodium azide,50% glycerol
Quelle: Rabbit
Sequenz: DKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNT
Target-Kategorie: LAMP1
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IHC-P,1:50 - 1:200