LAMP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16895T
Artikelname: LAMP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16895T
Hersteller Artikelnummer: CNA16895T
Alternativnummer: MBL-CNA16895T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human LAMP1 (NP_005552.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 3916
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNT
Target-Kategorie: LAMP1
Application Verdünnung: WB: WB,1:500 - 1:1000