Insulin Receptor Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16900T
Artikelname: Insulin Receptor Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16900T
Hersteller Artikelnummer: CNA16900T
Alternativnummer: MBL-CNA16900T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1281-1382 of human INSR (NP_000199.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 156kDa
NCBI: 3643
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS
Target-Kategorie: INSR
Application Verdünnung: WB: WB,1:500 - 1:2000|IP,1:500 - 1:1000