Lamin B1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16910T
Artikelname: Lamin B1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16910T
Hersteller Artikelnummer: CNA16910T
Alternativnummer: MBL-CNA16910T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 397-586 of human Lamin B1 (NP_005564.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 66kDa
NCBI: 4001
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM
Target-Kategorie: LMNB1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200