Smad2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16912P
Artikelname: Smad2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16912P
Hersteller Artikelnummer: CNA16912P
Alternativnummer: MBL-CNA16912P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 175-270 of human Smad2 (NP_005892.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 52kDa
NCBI: 4087
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: LPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSE
Target-Kategorie: SMAD2
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200