NAIP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16924T
Artikelname: NAIP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16924T
Hersteller Artikelnummer: CNA16924T
Alternativnummer: MBL-CNA16924T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 750-850 of human NAIP (NP_075043.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 160kDa
NCBI: 4671
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LLRSIHFPIRGNKTSPRAHFSVLETCFDKSQVPTIDQDYASAFEPMNEWERNLAEKEDNVKSYMDMQRRASPDLSTGYWKLSPKQYKIPCLEVDVNDIDVV
Target-Kategorie: NAIP
Application Verdünnung: WB: WB,1:500 - 1:2000