PDHA2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16944T
Artikelname: PDHA2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16944T
Hersteller Artikelnummer: CNA16944T
Alternativnummer: MBL-CNA16944T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of mouse PDHA2 (NP_032837.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 18598
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: ISYRSREEVHNVRSKSDPIMLLRERIISNNLSNIEELKEIDADVKKEVEDAAQFATTDPEPAVEDIANYLYHQDPPFEVRGAHKWLKYKSHS
Target-Kategorie: Pdha2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200