PEDF/SERPINF1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16946T
Artikelname: PEDF/SERPINF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16946T
Hersteller Artikelnummer: CNA16946T
Alternativnummer: MBL-CNA16946T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human PEDF/SERPINF1 (NP_002606.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 5176
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: IKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAV
Target-Kategorie: SERPINF1
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200