ADRA2C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16956T
Artikelname: ADRA2C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16956T
Hersteller Artikelnummer: CNA16956T
Alternativnummer: MBL-CNA16956T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 240-380 of human ADRA2C (NP_000674.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 152
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RTRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGALRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRRRRARSSVCRRKVAQAREKRF
Target-Kategorie: ADRA2C
Application Verdünnung: WB: WB,1:500 - 1:2000