PTEN Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16965T
Artikelname: PTEN Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16965T
Hersteller Artikelnummer: CNA16965T
Alternativnummer: MBL-CNA16965T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PTEN (NP_000305.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 5728
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMF
Target-Kategorie: PTEN
Application Verdünnung: WB: WB,1:500 - 1:2000