SFSWAP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16973T
Artikelname: SFSWAP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16973T
Hersteller Artikelnummer: CNA16973T
Alternativnummer: MBL-CNA16973T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 170-280 of human SFSWAP (NP_004583.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 105kDa
NCBI: 6433
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SKQREKNEAENLEENEEPFVAPLGLSVPSDVELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSG
Target-Kategorie: SFSWAP
Application Verdünnung: WB: WB,1:500 - 1:2000