TOP3A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16987T
Artikelname: TOP3A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16987T
Hersteller Artikelnummer: CNA16987T
Alternativnummer: MBL-CNA16987T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TOP3A (XP_011522303.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 112kDa
NCBI: 7156
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MILARNYLDVYPYDHWSDKILPVYEQGSHFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLTPDKRFLPGHLGMGLVE
Target-Kategorie: TOP3A
Application Verdünnung: WB: WB,1:500 - 1:2000