KIR2DL3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1698S
Artikelname: KIR2DL3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1698S
Hersteller Artikelnummer: CNA1698S
Alternativnummer: MBL-CNA1698S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-245 of human KIR2DL3 (NP_056952.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 3804
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
Target-Kategorie: KIR2DL3
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200