WIPF1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA17003T
Artikelname: WIPF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA17003T
Hersteller Artikelnummer: CNA17003T
Alternativnummer: MBL-CNA17003T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human WIPF1 (NP_001070737.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 7456
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QLPSRSGVDSPRSGPRPPLPPDRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNRRERGAPPLPP
Target-Kategorie: WIPF1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200