WNT7B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA17004S
Artikelname: WNT7B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA17004S
Hersteller Artikelnummer: CNA17004S
Alternativnummer: MBL-CNA17004S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 120-349 of human WNT7B (NP_478679.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 7477
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: TAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
Target-Kategorie: WNT7B
Application Verdünnung: WB: WB,1:500 - 1:2000