AXIN2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA17022T
Artikelname: AXIN2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA17022T
Hersteller Artikelnummer: CNA17022T
Alternativnummer: MBL-CNA17022T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human AXIN2 (NP_004646.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 94kDa
NCBI: 8313
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: EDEEREGSELTLNSREGAPTQHPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSLLPPGGKLPPAAASPGACPLL
Target-Kategorie: AXIN2
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200