Beclin 1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA17028T
Artikelname: Beclin 1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA17028T
Hersteller Artikelnummer: CNA17028T
Alternativnummer: MBL-CNA17028T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Beclin 1 (NP_003757.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 52kDa
NCBI: 8678
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQM
Target-Kategorie: BECN1
Application Verdünnung: WB: WB,1:500 - 1:1000