SOCS2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA17035T
Artikelname: SOCS2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA17035T
Hersteller Artikelnummer: CNA17035T
Alternativnummer: MBL-CNA17035T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human SOCS2 (NP_001257400.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 8835
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
Target-Kategorie: SOCS2
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100