CD9 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1703P
Artikelname: CD9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1703P
Hersteller Artikelnummer: CNA1703P
Alternativnummer: MBL-CNA1703P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 112-195 of human CD9 (NP_001760.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 928
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Target-Kategorie: CD9
Application Verdünnung: WB: WB,1:2000 - 1:8000|IHC-P,1:50 - 1:200