Bmi1 Rabbit mAb, Clone: [ARC0376], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA17914S
| Artikelname: |
Bmi1 Rabbit mAb, Clone: [ARC0376], Unconjugated, Monoclonal |
| Artikelnummer: |
MBL-CNA17914S |
| Hersteller Artikelnummer: |
CNA17914S |
| Alternativnummer: |
MBL-CNA17914S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 227-326 of human Bmi1 (P35226). |
| Konjugation: |
Unconjugated |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[ARC0376] |
| Molekulargewicht: |
37kDa |
| NCBI: |
648 |
| Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequenz: |
VRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG |
| Target-Kategorie: |
BMI1 |
| Application Verdünnung: |
WB: WB,1:500 - 1:1000 |
