ASB2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA17923T
Artikelname: ASB2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA17923T
Hersteller Artikelnummer: CNA17923T
Alternativnummer: MBL-CNA17923T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 448-587 of human ASB2 (NP_057234.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 70kDa
NCBI: 51676
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MDLGCDGEPCFSCLYGNGPHPPAPQPSSRFNDAPAADKEPSVVQFCEFVSAPEVSRWAGPIIDVLLDYVGNVQLCSRLKEHIDSFEDWAVIKEKAEPPRPLAHLCRLRVRKAIGKYRIKLLDTLPLPGRLIRYLKYENTQ
Target-Kategorie: ASB2
Application Verdünnung: WB: WB,1:500 - 1:2000