NIPSNAP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA17951P
Artikelname: NIPSNAP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA17951P
Hersteller Artikelnummer: CNA17951P
Alternativnummer: MBL-CNA17951P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 70-145 of human NIPSNAP1 (NP_003625.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 8508
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: NLYKIQFHNVKPEYLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNN
Target-Kategorie: NIPSNAP1
Application Verdünnung: WB: WB,1:500 - 1:1000