MT-ATP6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA17960T
Artikelname: MT-ATP6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA17960T
Hersteller Artikelnummer: CNA17960T
Alternativnummer: MBL-CNA17960T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-50 of human MT-ATP6 (YP_003024031.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 4508
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQWLI
Target-Kategorie: MT-ATP6
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100