MT-ND4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA17970P
Artikelname: MT-ND4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA17970P
Hersteller Artikelnummer: CNA17970P
Alternativnummer: MBL-CNA17970P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-459 of human MT-ND4 (YP_002124311.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 52kDa
NCBI: 4538
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MLVTALYSLYMFTTTQWGSLTHHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS
Target-Kategorie: MT-ND4
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200