OVOL2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA17973T
Artikelname: OVOL2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA17973T
Hersteller Artikelnummer: CNA17973T
Alternativnummer: MBL-CNA17973T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-98 of human OVOL2 (NP_067043.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 58495
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DEKRADTYIPVGLGRLLHDPPEDCRSDGGSSSGSGSSSAGEPGGAESSSSPHAPESETPEPGDAEGPDGHLATKQ
Target-Kategorie: OVOL2
Application Verdünnung: WB: WB,1:500 - 1:1000