ZDHHC7 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA17981T
Artikelname: ZDHHC7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA17981T
Hersteller Artikelnummer: CNA17981T
Alternativnummer: MBL-CNA17981T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 210 to the C-terminus of human ZDHHC7 (NP_060210.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 55625
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DFSPPITVILLIFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFSV
Target-Kategorie: ZDHHC7
Application Verdünnung: WB: WB,1:500 - 1:2000