ACP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1801S
Artikelname: ACP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1801S
Hersteller Artikelnummer: CNA1801S
Alternativnummer: MBL-CNA1801S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 15-144 of human ACP1 (NP_004291.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 18kDa
NCBI: 52
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQ
Target-Kategorie: ACP1
Application Verdünnung: WB: WB,1:500 - 1:2000