SDHB Rabbit mAb, Clone: [ARC0733], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA1809S
Artikelname: SDHB Rabbit mAb, Clone: [ARC0733], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA1809S
Hersteller Artikelnummer: CNA1809S
Alternativnummer: MBL-CNA1809S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 181-280 of human SDHB (P21912).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0733]
Molekulargewicht: 32kDa
NCBI: 6390
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
Target-Kategorie: SDHB
Application Verdünnung: WB: WB,1:500 - 1:1000