AMOTL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18112T
Artikelname: AMOTL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18112T
Hersteller Artikelnummer: CNA18112T
Alternativnummer: MBL-CNA18112T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 810-900 of human AMOTL1 (NP_570899.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 107kDa
NCBI: 154810
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LTSSQLAEEKKEEKTWKGSIGLLLGKEHHEHASAPLLPPPPTSALSSIASTTAASSAHAKTGSKDSSTQTDKSAELFWPSMASLPSRGRLS
Target-Kategorie: AMOTL1
Application Verdünnung: WB: WB,1:500 - 1:2000