TEX101 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18118T
Artikelname: TEX101 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18118T
Hersteller Artikelnummer: CNA18118T
Alternativnummer: MBL-CNA18118T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 44-150 of human TEX101 (NP_113639.4).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 83639
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPGLIVTSYSNYCEDSFCNDKDSLSQFWEFSETTAS
Target-Kategorie: TEX101
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200