FBXW8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18122T
Artikelname: FBXW8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18122T
Hersteller Artikelnummer: CNA18122T
Alternativnummer: MBL-CNA18122T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-598 of human FBXW8 (NP_699179.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 67kDa
NCBI: 26259
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: WDYRMNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV
Target-Kategorie: FBXW8
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200