PML Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18134S
Artikelname: PML Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18134S
Hersteller Artikelnummer: CNA18134S
Alternativnummer: MBL-CNA18134S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 510 to the C-terminus of human PML (NP_150243.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 98kDa
NCBI: 5371
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: RPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSVSGPEVQPRTPASPHFRSQGAQPQQVTLRLALRLGNFPVRH
Target-Kategorie: PML
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200