PIN4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18173T
Artikelname: PIN4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18173T
Hersteller Artikelnummer: CNA18173T
Alternativnummer: MBL-CNA18173T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 26-156 of human PIN4 (NP_006214.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 5303
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Target-Kategorie: PIN4
Application Verdünnung: WB: WB,1:500 - 1:1000