ERCC6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18211P
Artikelname: ERCC6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18211P
Hersteller Artikelnummer: CNA18211P
Alternativnummer: MBL-CNA18211P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700-800 of human ERCC6 (NP_000115.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 168kDa
NCBI: 2074
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: LPVFMEQFSVPITMGGYSNASPVQVKTAYKCACVLRDTINPYLLRRMKSDVKMSLSLPDKNEQVLFCRLTDEQHKVYQNFVDSKEVYRILNGEMQIFSGLI
Target-Kategorie: ERCC6
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200