MRPL38 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18239T
Artikelname: MRPL38 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18239T
Hersteller Artikelnummer: CNA18239T
Alternativnummer: MBL-CNA18239T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 35-380 of human MRPL38 (NP_115867.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 64978
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MPNSDIDLSNLERLEKYRSFDRYRRRAEQEAQAPHWWRTYREYFGEKTDPKEKIDIGLPPPKVSRTQQLLERKQAIQELRANVEEERAARLRTASVPLDAVRAEWERTCGPYHKQRLAEYYGLYRDLFHGATFVPRVPLHVAYAVGEDDLMPVYCGNEVTPTEAAQAPEVTYEAEEGSLWTLLLTSLDGHLLEPDAEYLHWLLTNIPGNRVAEGQVTCPYLPPFPARGSGIHRLAFLLFKQDQPIDFSEDARPS
Target-Kategorie: MRPL38
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200