HSD3B2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1823P
Artikelname: HSD3B2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1823P
Hersteller Artikelnummer: CNA1823P
Alternativnummer: MBL-CNA1823P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-287 of human HSD3B2 (NP_000189.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 3284
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYY
Target-Kategorie: HSD3B2
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:10 - 1:100