[KO Validated] ATM Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18257T
Artikelname: [KO Validated] ATM Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18257T
Hersteller Artikelnummer: CNA18257T
Alternativnummer: MBL-CNA18257T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2320-2566 of ATM (NP_000042.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 351kDa
NCBI: 472
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DASCAANNPSLKLTYTECLRVCGNWLAETCLENPAVIMQTYLEKAVEVAGNYDGESSDELRNGKMKAFLSLARFSDTQYQRIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANA
Target-Kategorie: ATM
Application Verdünnung: WB: WB,1:100 - 1:500