PSMD6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18263T
Artikelname: PSMD6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18263T
Hersteller Artikelnummer: CNA18263T
Alternativnummer: MBL-CNA18263T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 23-307 of human PSMD6 (NP_055629.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 9861
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLA
Target-Kategorie: PSMD6
Application Verdünnung: WB: WB,1:500 - 1:2000