GluR1/GRIA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1826T
Artikelname: GluR1/GRIA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1826T
Hersteller Artikelnummer: CNA1826T
Alternativnummer: MBL-CNA1826T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 330-470 of human GluR1/GRIA1 (NP_000818.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 102kDa
NCBI: 2890
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPD
Target-Kategorie: GRIA1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200