GYPA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1827S
Artikelname: GYPA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1827S
Hersteller Artikelnummer: CNA1827S
Alternativnummer: MBL-CNA1827S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-91 of human GYPA (P02724).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 2993
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE
Target-Kategorie: GYPA
Application Verdünnung: WB: WB,1:500 - 1:2000