TXLNA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18291P
Artikelname: TXLNA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18291P
Hersteller Artikelnummer: CNA18291P
Alternativnummer: MBL-CNA18291P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TXLNA (NP_787048.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 200081
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQ
Target-Kategorie: TXLNA
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200