PRK2/PKN2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18373T
Artikelname: PRK2/PKN2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18373T
Hersteller Artikelnummer: CNA18373T
Alternativnummer: MBL-CNA18373T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of human PRK2/PRK2/PKN2 (NP_006247.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 112kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCCAVLGRGHFGKVLLAEYKNTNEMFAIKALKKGDIVARDEVD
Target-Kategorie: PKN2
Application Verdünnung: WB: WB,1:500 - 1:2000