RPS8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18377T
Artikelname: RPS8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18377T
Hersteller Artikelnummer: CNA18377T
Alternativnummer: MBL-CNA18377T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human RPS8 (NP_001003.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 24kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: KRRKTGGKRKPYHKKRKYELGRPAANTKIGPRRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNC
Target-Kategorie: RPS8
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200