HCAR3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18400T
Artikelname: HCAR3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18400T
Hersteller Artikelnummer: CNA18400T
Alternativnummer: MBL-CNA18400T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-392 of human HCAR3 (NP_006009.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 44kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SFPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSGEPWSPSYLGPTSNNHSKKGHCHQEPASLEKQLGCCIE
Target-Kategorie: HCAR3
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200