SMC3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18402T
Artikelname: SMC3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18402T
Hersteller Artikelnummer: CNA18402T
Alternativnummer: MBL-CNA18402T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 909-1199 of human SMC3 (NP_005436.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 142kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: KEHMDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIM
Target-Kategorie: SMC3
Application Verdünnung: WB: WB,1:500 - 1:2000|IP,1:500 - 1:1000